Tagzania is closing
Next March 31st Tagzania will stop working. Be sure to download all your data in your profile view before that date. Thank you for all your support these years.
Tagzania ixtera doa
Datorren martxoak 31an Tagzania itxiko dugu. Ziurtatu zure datu guztiak deskargatzen dituzula zure profiletik egun hori baino lehen. Eskerrik asko urte guzti hauetako babesagatik.
vegan
Last items tagged with vegan.
Near
Nearest
-
Lucky Palate Vegetarian Meal Service
Tasty, affordable, vegetarian meals delivered to your home or business. ...
-
Ruva Plantborn Nutrition
We make great tasting protein powders and quality supplements -100% ...
-
Herb 'N Flavors | Organic Restaurant
1845 East Broadway Road, Tempe, AZ, 85281, 480-967-2789, h.n.flavors@gmail.com
-
Radha Yoga and Eatery
604-605-0011
Accept credit cards. Open lunch M-F 11:30-3, dinner Thur-Sat ...
Hotels
Users
- jeffbatso
- ravdeep
- agisrawfoods55
- coolingcont
- mathbowman
- snjvh7
- grill092
- jwilsnack
- luckypalatevegetarianmealservice
- stealthopera
Page 1 / 2